PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G30610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 275aa    MW: 29793.3 Da    PI: 6.1071
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G30610.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.79.9e-172269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde l++ v++ G ++W+t +r+ g+ R++k+c++rw +yl
  ORUFI01G30610.1 22 RGPWTPEEDEVLARFVAREGCDRWRTLPRRAGLLRCGKSCRLRWMNYL 69
                     89******************************99************97 PP

2Myb_DNA-binding45.71.5e-1480120648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  ORUFI01G30610.1  80 DDEEDLILRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 120
                      58***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.0961769IPR017930Myb domain
SuperFamilySSF466891.04E-2720116IPR009057Homeodomain-like
SMARTSM007171.3E-102171IPR001005SANT/Myb domain
PfamPF002491.3E-142269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-202376IPR009057Homeodomain-like
CDDcd001679.63E-102469No hitNo description
PROSITE profilePS5129424.80570124IPR017930Myb domain
SMARTSM007172.9E-1374122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2377125IPR009057Homeodomain-like
CDDcd001672.96E-1180120No hitNo description
PfamPF002494.2E-1381120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MKRKRPAALR GGEEAAAAAL KRGPWTPEED EVLARFVARE GCDRWRTLPR RAGLLRCGKS  60
CRLRWMNYLR PDIKRCPIAD DEEDLILRLH RLLGNRWSLI AGRLPGRTDN EIKNYWNSHL  120
SKKLIAQGID PRTHKPLTAA ADHSNAAAAV AATSYKKAVP AKPPRTASSP AAGIECSDDR  180
ARPADGGGDF AAMVSAADAE GFEGGFGDQF CAEDAVHGGF DMGSASAMVG DDDFSSFLDS  240
LINDEQLGDL FVVEGNDHEH GNGEIGHGDV MESKQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27201245108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1082590.0AK108259.1 Oryza sativa Japonica Group cDNA clone:002-141-A12, full insert sequence.
GenBankD886200.0D88620.1 Oryza sativa mRNA for OSMYB4, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644524.10.0PREDICTED: transcription repressor MYB5
SwissprotQ388503e-75MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A0E0N1730.0A0A0E0N173_ORYRU; Uncharacterized protein
TrEMBLI1NQY10.0I1NQY1_ORYGL; Uncharacterized protein
TrEMBLO238920.0O23892_ORYSA;
TrEMBLQ7F3D60.0Q7F3D6_ORYSJ; Myb-related protein 1-like
STRINGLOC_Os01g50110.10.0(Oryza sativa Japonica Group)
STRINGORGLA01G0227100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.13e-67myb domain protein 5